PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.361050.1
Common NameCsa_7G452880, LOC101214316
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 347aa    MW: 38197.9 Da    PI: 6.8858
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.361050.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.2e-13107151347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ I+r +  +Rt+ q+ s+ qky
   Cucsa.361050.1 107 PWTEEEHRLFLVGLQKLGKGDWRGISRNFVITRTPTQVASHAQKY 151
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.813100156IPR017930Myb domain
SuperFamilySSF466892.77E-17102157IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-18103155IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.2E-11104150IPR009057Homeodomain-like
SMARTSM007173.4E-11104154IPR001005SANT/Myb domain
CDDcd001671.51E-9107152No hitNo description
PfamPF002497.0E-12107151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RAGGGGGSGA GVKLFGVRLT DGSFIKKSAS MGNLSVHYHS  60
SSSAAASPNP DSPNSDPVHD SDGFLSDDPA HASCSANRRA ERKKGVPWTE EEHRLFLVGL  120
QKLGKGDWRG ISRNFVITRT PTQVASHAQK YFIRQSNATR RKRRSSLFDM VPEMATDPLP  180
VPEDEILHAS QTKETENSNS QPSLNLSLNS EFHMMETTVE ENGKELHVPK MEVAGFPPVI  240
PGFIPAYMPV PFPIWAPSSF PMEEENVVET CHHEVLKPIP VVPTEPVNVD ELVGMSQLTL  300
REYERERREP SPLSLKLIGE RSRQSAFHPN APVSRSELIK DDTDTI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818050.0LN681805.1 Cucumis melo genomic scaffold, anchoredscaffold00067.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141664.10.0PREDICTED: uncharacterized protein LOC101214316
TrEMBLA0A0A0K9S00.0A0A0A0K9S0_CUCSA; Uncharacterized protein
STRINGGLYMA13G43120.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.12e-90MYB_related family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]